LY6G6F anticorps (N-Term)

N° du produit ABIN630316

Détail du produit anti-LY6G6F anticorps

Antigène: LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LY6G6F est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C6 ORF21 antibody was raised against the N terminal Of C6 rf21

Purification: Purified

Immunogène: C6 ORF21 antibody was raised using the N terminal Of C6 rf21 corresponding to a region with amino acids CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF21 Blocking Peptide, catalog no. 33R-1813, is also available for use as a blocking control in assays to test for specificity of this C6ORF21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LY6G6F

Antigène: LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))

Autre désignation: C6ORF21 (LY6G6F Produits)

Synonymes: anticorps C6orf21, anticorps G6f, anticorps LY6G6D, anticorps NG32, anticorps CJ068215, anticorps C6ORF21, anticorps lymphocyte antigen 6 family member G6F, anticorps lymphocyte antigen 6 complex, locus G6F, anticorps LY6G6F, anticorps Ly6g6f

Sujet: C6ORF21 may play a role in the downstream signal transduction pathways involving GRB2 and GRB7.

Poids moléculaire: 31 kDa (MW of target protein)