COX IV anticorps (N-Term)
-
- Antigène Voir toutes COX IV (COX4I1) Anticorps
- COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COX IV est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- COX4 I1 antibody was raised against the N terminal of COX4 1
- Purification
- Purified
- Immunogène
- COX4 I1 antibody was raised using the N terminal of COX4 1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
- Top Product
- Discover our top product COX4I1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 2 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
COX4I1 Blocking Peptide, catalog no. 33R-1282, is also available for use as a blocking control in assays to test for specificity of this COX4I1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))
- Autre désignation
- COX4I1 (COX4I1 Produits)
- Synonymes
- anticorps COX4, anticorps COX4-1, anticorps COXIV, anticorps mg:bb02d03, anticorps zgc:110058, anticorps GB20012, anticorps AL024441, anticorps Cox4, anticorps Cox4a, anticorps cox4, anticorps cox4i1, anticorps coxiv, anticorps BcDNA:AT07685, anticorps CG10396, anticorps COX IV, anticorps CX41, anticorps CX42, anticorps Dmel\CG10396, anticorps IV, anticorps cytochrome c oxidase subunit 4I1, anticorps cytochrome c oxidase subunit IV isoform 1, anticorps cytochrome c oxidase subunit 4 isoform 1, mitochondrial, anticorps cytochrome c oxidase polypeptide IV, anticorps cytochrome c oxidase subunit IV, anticorps cytochrome c oxidase subunit 4i1, anticorps cytochrome c oxidase subunit IV isoform 1 S homeolog, anticorps Cytochrome c oxidase subunit 4-like, anticorps COX4I1, anticorps cox4i1, anticorps LOC412396, anticorps Cox4I1, anticorps LOC780848, anticorps BMEII0322, anticorps RSal33209_1582, anticorps SJAG_00976, anticorps HMPREF0733_11926, anticorps Cox4i1, anticorps cox4i1.S, anticorps COX4L
- Sujet
- Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.
- Poids moléculaire
- 19 kDa (MW of target protein)
- Pathways
- Proton Transport
-