COX15 anticorps
-
- Antigène Voir toutes COX15 Anticorps
- COX15 (Cytochrome C Oxidase Assembly Homolog 15 (COX15))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COX15 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Purified
- Immunogène
- COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
- Top Product
- Discover our top product COX15 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
COX15 Blocking Peptide, catalog no. 33R-2231, is also available for use as a blocking control in assays to test for specificity of this COX15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COX15 (Cytochrome C Oxidase Assembly Homolog 15 (COX15))
- Autre désignation
- COX15 (COX15 Produits)
- Synonymes
- anticorps COX15, anticorps wu:fa18g06, anticorps zgc:56240, anticorps zgc:77422, anticorps 2900026G05Rik, anticorps CEMCOX2, anticorps COX15, cytochrome c oxidase assembly homolog, anticorps COX15 homolog, cytochrome c oxidase assembly protein (yeast), anticorps COX15 cytochrome c oxidase assembly homolog, anticorps cytochrome c oxidase assembly homolog 15 (yeast), anticorps cytochrome c oxidase assembly protein 15, anticorps cytochrome c oxidase assembly protein COX15 homolog, anticorps COX15, anticorps Cox15, anticorps cox15, anticorps LOC100410987, anticorps LOC100599631
- Sujet
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.
- Poids moléculaire
- 44 kDa (MW of target protein)
-