SLC25A46 anticorps (N-Term)
-
- Antigène Voir toutes SLC25A46 Anticorps
- SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A46 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC25 A46 antibody was raised against the N terminal of SLC25 46
- Purification
- Purified
- Immunogène
- SLC25 A46 antibody was raised using the N terminal of SLC25 46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP
- Top Product
- Discover our top product SLC25A46 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A46 Blocking Peptide, catalog no. 33R-8179, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 46 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))
- Autre désignation
- SLC25A46 (SLC25A46 Produits)
- Synonymes
- anticorps SLC25A46, anticorps MGC152354, anticorps zgc:92767, anticorps slc25a46, anticorps 1200007B05Rik, anticorps AI325987, anticorps RGD1305072, anticorps solute carrier family 25 member 46, anticorps solute carrier family 25, member 46, anticorps solute carrier family 25 member 46 L homeolog, anticorps SLC25A46, anticorps slc25a46, anticorps slc25a46.L, anticorps Slc25a46
- Sujet
- SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
- Poids moléculaire
- 46 kDa (MW of target protein)
-