LETM1 anticorps (Middle Region)
-
- Antigène Voir toutes LETM1 Anticorps
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LETM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LETM1 antibody was raised against the middle region of LETM1
- Purification
- Purified
- Immunogène
- LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
- Top Product
- Discover our top product LETM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LETM1 Blocking Peptide, catalog no. 33R-5689, is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
- Autre désignation
- LETM1 (LETM1 Produits)
- Synonymes
- anticorps LETM1, anticorps wu:fc31h08, anticorps wu:fc58h01, anticorps zgc:109969, anticorps letm1, anticorps MGC145623, anticorps leucine zipper and EF-hand containing transmembrane protein 1, anticorps leucine zipper-EF-hand containing transmembrane protein 1, anticorps LETM1 and EF-hand domain-containing protein 1, mitochondrial, anticorps LETM1, anticorps letm1, anticorps LOC100346816, anticorps Letm1
- Sujet
- The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.
- Poids moléculaire
- 60 kDa (MW of target protein)
-