TMEM91 anticorps (N-Term)
-
- Antigène Tous les produits TMEM91
- TMEM91 (Transmembrane Protein 91 (TMEM91))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM91 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM91 antibody was raised against the N terminal of TMEM91
- Purification
- Purified
- Immunogène
- TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM91 Blocking Peptide, catalog no. 33R-8688, is also available for use as a blocking control in assays to test for specificity of this TMEM91 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM91 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM91 (Transmembrane Protein 91 (TMEM91))
- Autre désignation
- TMEM91 (TMEM91 Produits)
- Synonymes
- anticorps DSPC3, anticorps IFITMD6, anticorps A830041P22Rik, anticorps transmembrane protein 91, anticorps TMEM91, anticorps Tmem91
- Sujet
- The function of TMEM91 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 15 kDa (MW of target protein)
-