Pannexin 2 anticorps (N-Term)
-
- Antigène Voir toutes Pannexin 2 (PANX2) Anticorps
- Pannexin 2 (PANX2)
-
Épitope
- N-Term
-
Reactivité
- Mammifères
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Pannexin 2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Pannexin 2 antibody was raised against the N terminal of PANX2
- Réactivité croisée
- Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)
- Purification
- Purified
- Immunogène
- Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
- Top Product
- Discover our top product PANX2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Pannexin 2 Blocking Peptide, catalog no. 33R-3625, is also available for use as a blocking control in assays to test for specificity of this Pannexin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Pannexin 2 (PANX2)
- Autre désignation
- Pannexin 2 (PANX2 Produits)
- Sujet
- PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.
- Poids moléculaire
- 70 kDa (MW of target protein)
-