SLC41A2 anticorps (N-Term)
-
- Antigène Voir toutes SLC41A2 Anticorps
- SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC41A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC41 A2 antibody was raised against the N terminal of SLC41 2
- Purification
- Purified
- Immunogène
- SLC41 A2 antibody was raised using the N terminal of SLC41 2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
- Top Product
- Discover our top product SLC41A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC41A2 Blocking Peptide, catalog no. 33R-8340, is also available for use as a blocking control in assays to test for specificity of this SLC41A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))
- Autre désignation
- SLC41A2 (SLC41A2 Produits)
- Synonymes
- anticorps MGC83802, anticorps slc41a1-l1, anticorps SLC41A1-L1, anticorps A230035L05Rik, anticorps solute carrier family 41 member 2, anticorps solute carrier family 41 member 2 L homeolog, anticorps solute carrier family 41, member 2, anticorps Slc41a2, anticorps slc41a2.L, anticorps SLC41A2, anticorps slc41a2
- Sujet
- SLC41A2 acts as a plasma-membrane magnesium transporter.
- Poids moléculaire
- 53 kDa (MW of target protein)
-