SEC63 anticorps
-
- Antigène Voir toutes SEC63 Anticorps
- SEC63 (SEC63 Homolog (SEC63))
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEC63 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
- Top Product
- Discover our top product SEC63 Anticorps primaire
-
anti-SEC63 Homolog (SEC63) (AA 631-728) antibody
SEC63 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1A8 unconjugated
anti-SEC63 Homolog (SEC63) (C-Term) antibodySEC63 Reactivité: Humain, Souris, Rat WB, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 1-760) antibodySEC63 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 139-168), (N-Term) antibodySEC63 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB32397 unconjugated
anti-SEC63 Homolog (SEC63) (AA 651-700) antibodySEC63 Reactivité: Humain, Souris, Rat, Lapin, Poisson zèbre (Danio rerio), Chien, Cobaye, Boeuf (Vache), Cheval, Roussette (Chauve-souris), Singe, Poulet, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 35-84) antibodySEC63 Reactivité: Humain, Souris, Rat, Lapin, Poisson zèbre (Danio rerio), Chien, Cobaye, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (AA 139-168) antibodySEC63 Reactivité: Humain WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-SEC63 Homolog (SEC63) (N-Term) antibodySEC63 Reactivité: Humain, Souris, Rat, Lapin, Poisson zèbre (Danio rerio), Cobaye, Boeuf (Vache), Cheval WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SEC63 Blocking Peptide, catalog no. 33R-10039, is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEC63 (SEC63 Homolog (SEC63))
- Autre désignation
- SEC63 (SEC63 Produits)
- Synonymes
- anticorps DNAJC23, anticorps ERdj2, anticorps PRO2507, anticorps SEC63L, anticorps 5730478J10Rik, anticorps AI649014, anticorps AW319215, anticorps SEC63-like, anticorps zgc:92718, anticorps SEC63 homolog, protein translocation regulator, anticorps SEC63-like (S. cerevisiae), anticorps SEC63 homolog, protein translocation regulator L homeolog, anticorps SEC63, anticorps Sec63, anticorps sec63, anticorps sec63.L
- Sujet
- The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.
- Poids moléculaire
- 88 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-
