S1PR5 anticorps (N-Term)

N° du produit ABIN630339

Détail du produit anti-S1PR5 anticorps

Antigène: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp S1PR5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: EDG8 antibody was raised against the N terminal of EDG8

Purification: Purified

Immunogène: EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EDG8 Blocking Peptide, catalog no. 33R-5958, is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur S1PR5

Antigène: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Autre désignation: EDG8 (S1PR5 Produits)

Synonymes: anticorps EDG8, anticorps Edg-8, anticorps S1P5, anticorps SPPR-1, anticorps SPPR-2, anticorps fd11a07, anticorps wu:fd11a07, anticorps zgc:92296, anticorps edg-8, anticorps edg8, anticorps s1p5, anticorps sppr-1, anticorps sppr-2, anticorps xts1p5, anticorps Edg8, anticorps lpB4, anticorps zgc:158362, anticorps sphingosine-1-phosphate receptor 5, anticorps sphingosine-1-phosphate receptor 5a, anticorps sphingosine-1-phosphate receptor 5b, anticorps S1PR5, anticorps s1pr5a, anticorps s1pr5, anticorps S1pr5, anticorps s1pr5b

Sujet: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

Poids moléculaire: 16 kDa (MW of target protein)