S1PR5 anticorps (N-Term)
-
- Antigène Voir toutes S1PR5 Anticorps
- S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien, Drosophila melanogaster, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp S1PR5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- EDG8 antibody was raised against the N terminal of EDG8
- Purification
- Purified
- Immunogène
- EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
- Top Product
- Discover our top product S1PR5 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EDG8 Blocking Peptide, catalog no. 33R-5958, is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))
- Autre désignation
- EDG8 (S1PR5 Produits)
- Sujet
- EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
- Poids moléculaire
- 16 kDa (MW of target protein)
-