SRPRB anticorps (C-Term)

N° du produit ABIN630341

Détail du produit anti-SRPRB anticorps

Antigène: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRPRB est non-conjugé

Application: Western Blotting (WB)

Specificité: SRPRB antibody was raised against the C terminal of SRPRB

Purification: Purified

Immunogène: SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRPRB Blocking Peptide, catalog no. 33R-1415, is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRPRB

Antigène: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Autre désignation: SRPRB (SRPRB Produits)

Synonymes: anticorps wu:fk57h10, anticorps zgc:111820, anticorps zgc:92746, anticorps apmcf1, anticorps APMCF1, anticorps AA409543, anticorps Ab2-417, anticorps Ba1-667, anticorps Cc1-8, anticorps signal recognition particle receptor, B subunit, anticorps SRP receptor beta subunit S homeolog, anticorps SRP receptor beta subunit, anticorps SRPRB, anticorps srprb, anticorps srprb.S, anticorps Srprb

Sujet: SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling