AGPAT2 anticorps (C-Term)

N° du produit ABIN630343

Détail du produit anti-AGPAT2 anticorps

Antigène: AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGPAT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: AGPAT2 antibody was raised against the C terminal of AGPAT2

Purification: Purified

Immunogène: AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGPAT2 Blocking Peptide, catalog no. 33R-4874, is also available for use as a blocking control in assays to test for specificity of this AGPAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGPAT2

Antigène: AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))

Autre désignation: AGPAT2 (AGPAT2 Produits)

Synonymes: anticorps AGPAT2, anticorps zgc:153984, anticorps 1-agpat2, anticorps bscl, anticorps bscl1, anticorps lpaab, anticorps lpaat-beta, anticorps 1-AGPAT2, anticorps BSCL, anticorps BSCL1, anticorps LPAAB, anticorps LPAAT-beta, anticorps 2510002J07Rik, anticorps AV000834, anticorps 1-acylglycerol-3-phosphate O-acyltransferase 2, anticorps 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), anticorps AGPAT2, anticorps agpat2, anticorps Agpat2

Sujet: AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.

Poids moléculaire: 27 kDa (MW of target protein)