SGCG anticorps

N° du produit ABIN630345

Détail du produit anti-SGCG anticorps

Antigène: SGCG (Sarcoglycan, gamma (35kDa Dystrophin-Associated Glycoprotein) (SGCG))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SGCG est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGCG Blocking Peptide, catalog no. 33R-3107, is also available for use as a blocking control in assays to test for specificity of this SGCG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SGCG

Antigène: SGCG (Sarcoglycan, gamma (35kDa Dystrophin-Associated Glycoprotein) (SGCG))

Autre désignation: SGCG (SGCG Produits)

Synonymes: anticorps zgc:100924, anticorps A4, anticorps DAGA4, anticorps DMDA, anticorps DMDA1, anticorps LGMD2C, anticorps MAM, anticorps SCARMD2, anticorps SCG3, anticorps TYPE, anticorps 35DAG, anticorps Gamma-SG, anticorps 35kDa, anticorps 5430420E18Rik, anticorps AI642964, anticorps gamma-SG, anticorps sarcoglycan, gamma, anticorps sarcoglycan gamma, anticorps sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein), anticorps sarcoglycan, gamma (dystrophin-associated glycoprotein), anticorps sgcg, anticorps SGCG, anticorps Sgcg

Sujet: Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).

Poids moléculaire: 32 kDa (MW of target protein)