USP48 anticorps (Middle Region)
-
- Antigène Voir toutes USP48 Anticorps
- USP48 (Ubiquitin Specific Peptidase 48 (USP48))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp USP48 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- USP48 antibody was raised against the middle region of USP48
- Purification
- Purified
- Immunogène
- USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV
- Top Product
- Discover our top product USP48 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
USP48 Blocking Peptide, catalog no. 33R-1333, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP48 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- USP48 (Ubiquitin Specific Peptidase 48 (USP48))
- Autre désignation
- USP48 (USP48 Produits)
- Synonymes
- anticorps RAP1GA1, anticorps USP31, anticorps 2810449C13Rik, anticorps AI115503, anticorps BC021769, anticorps D330022K21Rik, anticorps Usp31, anticorps synUSP, anticorps USP48, anticorps MGC135142, anticorps zgc:112364, anticorps ubiquitin specific peptidase 48, anticorps ubiquitin specific peptidase 31, anticorps USP48, anticorps Usp48, anticorps usp48, anticorps USP31
- Sujet
- USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
- Poids moléculaire
- 70 kDa (MW of target protein)
-