CHIC1 anticorps (N-Term)
-
- Antigène Tous les produits CHIC1
- CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHIC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHIC1 antibody was raised against the N terminal of CHIC1
- Purification
- Purified
- Immunogène
- CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHIC1 Blocking Peptide, catalog no. 33R-5387, is also available for use as a blocking control in assays to test for specificity of this CHIC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))
- Autre désignation
- CHIC1 (CHIC1 Produits)
- Synonymes
- anticorps wu:fj33g02, anticorps BRX, anticorps Brx, anticorps cysteine-rich hydrophobic domain 1, anticorps cysteine rich hydrophobic domain 1, anticorps chic1, anticorps CHIC1, anticorps Chic1
- Sujet
- The function of CHIC protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 24 kDa (MW of target protein)
-