UBE2J1 anticorps

N° du produit ABIN630349

Détail du produit anti-UBE2J1 anticorps

Antigène: UBE2J1 (Ubiquitin-Conjugating Enzyme E2, J1, U (UBE2J1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2J1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: UBE2 J1 antibody was raised using a synthetic peptide corresponding to a region with amino acids METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2J1 Blocking Peptide, catalog no. 33R-5976, is also available for use as a blocking control in assays to test for specificity of this UBE2J1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2J1

Antigène: UBE2J1 (Ubiquitin-Conjugating Enzyme E2, J1, U (UBE2J1))

Autre désignation: UBE2J1 (UBE2J1 Produits)

Synonymes: anticorps NCUBE1, anticorps ubc6p, anticorps cgi-76, anticorps ncube1, anticorps hspc153, anticorps hspc205, anticorps hsu93243, anticorps HSPC153, anticorps HSPC205, anticorps HSU93243, anticorps NCUBE-1, anticorps UBC6, anticorps Ubc6p, anticorps zgc:63554, anticorps UB2J1, anticorps 0710008M05Rik, anticorps 1110030I22Rik, anticorps Ncube, anticorps Ncube1, anticorps ubiquitin conjugating enzyme E2 J1, anticorps ubiquitin-conjugating enzyme E2 J1, anticorps ubiquitin-conjugating enzyme E2, J1, anticorps ubiquitin conjugating enzyme E2 J1 L homeolog, anticorps ubiquitin-conjugating enzyme E2J 1, anticorps UBE2J1, anticorps EDI_253240, anticorps MCYG_03847, anticorps ube2j1, anticorps ube2j1.L, anticorps Ube2j1

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.

Poids moléculaire: 35 kDa (MW of target protein)