UBE2J2 anticorps
-
- Antigène Voir toutes UBE2J2 Anticorps
- UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBE2J2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- UBE2 J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
- Top Product
- Discover our top product UBE2J2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBE2J2 Blocking Peptide, catalog no. 33R-3342, is also available for use as a blocking control in assays to test for specificity of this UBE2J2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))
- Autre désignation
- UBE2J2 (UBE2J2 Produits)
- Synonymes
- anticorps NCUBE-2, anticorps NCUBE2, anticorps PRO2121, anticorps 1200007B18Rik, anticorps 2400008G19Rik, anticorps 5730472G04Rik, anticorps AL022923, anticorps Ubc6, anticorps Ubc6p, anticorps zgc:162164, anticorps ubiquitin conjugating enzyme E2 J2, anticorps ubiquitin-conjugating enzyme E2J 2, anticorps ubiquitin-conjugating enzyme E2, J2, anticorps ubiquitin-conjugating enzyme E2 J2, anticorps ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), anticorps ubiquitin conjugating enzyme E2 J2 L homeolog, anticorps UBE2J2, anticorps Ube2j2, anticorps LOC5574000, anticorps CpipJ_CPIJ008956, anticorps ube2j2, anticorps uce2, anticorps ube2j2.L, anticorps LOC100067387
- Sujet
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.
- Poids moléculaire
- 30 kDa (MW of target protein)
-