TRIM59 anticorps (Middle Region)
-
- Antigène Voir toutes TRIM59 Anticorps
- TRIM59 (Tripartite Motif Containing 59 (TRIM59))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRIM59 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- TRIM59 antibody was raised against the middle region of TRIM59
- Purification
- Purified
- Immunogène
- TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
- Top Product
- Discover our top product TRIM59 Anticorps primaire
-
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibody
TRIM59 Reactivité: Humain, Souris, Rat ELISA, WB, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 68-96), (N-Term) antibodyTRIM59 Reactivité: Humain WB, IF, IHC (p) Hôte: Lapin Polyclonal RB29690 unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 251-300) antibodyTRIM59 Reactivité: Humain, Souris, Rat, Cheval, Porc, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 191-240) antibodyTRIM59 Reactivité: Humain, Souris ELISA, WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibodyTRIM59 Reactivité: Humain, Souris WB, IF, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibodyTRIM59 Reactivité: Humain ELISA, WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 126-181) antibodyTRIM59 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibodyTRIM59 Reactivité: Humain, Souris ELISA, WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 51-100) antibodyTRIM59 Reactivité: Humain, Cheval, Porc, Boeuf (Vache), Lapin, Singe, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (N-Term) antibodyTRIM59 Reactivité: Humain, Chien WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRIM59 Blocking Peptide, catalog no. 33R-4912, is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRIM59 (Tripartite Motif Containing 59 (TRIM59))
- Autre désignation
- TRIM59 (TRIM59 Produits)
- Synonymes
- anticorps zgc:193694, anticorps zgc:193700, anticorps TRIM59, anticorps MRF1, anticorps RNF104, anticorps TRIM57, anticorps TSBF1, anticorps 2310035M22Rik, anticorps 2700022F13Rik, anticorps Mrf1, anticorps RGD1311956, anticorps LYR motif containing 9, anticorps tripartite motif containing 59, anticorps tripartite motif-containing 59, anticorps lyrm9, anticorps TRIM59, anticorps Trim59
- Sujet
- The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-
