NSDHL anticorps
-
- Antigène Voir toutes NSDHL Anticorps
- NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NSDHL est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
- Top Product
- Discover our top product NSDHL Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NSDHL Blocking Peptide, catalog no. 33R-7828, is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSDHL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))
- Autre désignation
- NSDHL (NSDHL Produits)
- Synonymes
- anticorps zgc:112474, anticorps H105E3, anticorps SDR31E1, anticorps XAP104, anticorps AI747449, anticorps Bpa, anticorps Str, anticorps NAD(P) dependent steroid dehydrogenase-like, anticorps NAD(P) dependent steroid dehydrogenase-like L homeolog, anticorps NSDHL, anticorps nsdhl, anticorps nsdhl.L, anticorps Nsdhl
- Sujet
- NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.
- Poids moléculaire
- 42 kDa (MW of target protein)
-