ABCD4 anticorps

N° du produit ABIN630357

Détail du produit anti-ABCD4 anticorps

Antigène: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCD4 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCD4 Blocking Peptide, catalog no. 33R-2911, is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCD4

Antigène: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Autre désignation: ABCD4 (ABCD4 Produits)

Synonymes: anticorps ABC41, anticorps EST352188, anticorps MAHCJ, anticorps P70R, anticorps P79R, anticorps PMP69, anticorps PXMP1L, anticorps Pxmp1l, anticorps ABCD4, anticorps zgc:153503, anticorps P69r, anticorps ATP binding cassette subfamily D member 4, anticorps ATP-binding cassette, sub-family D (ALD), member 4, anticorps ABCD4, anticorps Abcd4, anticorps abcd4

Sujet: ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis.

Poids moléculaire: 55 kDa (MW of target protein)