PTRH2 anticorps (C-Term)

N° du produit ABIN630358

Détail du produit anti-PTRH2 anticorps

Antigène: PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTRH2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTRH2 antibody was raised against the C terminal of PTRH2

Purification: Purified

Immunogène: PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTRH2 Blocking Peptide, catalog no. 33R-8080, is also available for use as a blocking control in assays to test for specificity of this PTRH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTRH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTRH2

Antigène: PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))

Autre désignation: PTRH2 (PTRH2 Produits)

Synonymes: anticorps BIT1, anticorps PTH2, anticorps A230072I16Rik, anticorps Bit1, anticorps CGI-147, anticorps wu:fj09f02, anticorps zgc:109954, anticorps RGD1306819, anticorps peptidyl-tRNA hydrolase 2, anticorps ptrh2, anticorps CC1G_10259, anticorps ANI_1_1036184, anticorps AOR_1_2082154, anticorps PTRH2, anticorps Ptrh2

Sujet: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

Poids moléculaire: 20 kDa (MW of target protein)