CLCC1 anticorps (N-Term)
-
- Antigène Voir toutes CLCC1 Anticorps
- CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLCC1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- CLCC1 antibody was raised against the N terminal of CLCC1
- Purification
- Purified
- Immunogène
- CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW
- Top Product
- Discover our top product CLCC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CLCC1 Blocking Peptide, catalog no. 33R-6106, is also available for use as a blocking control in assays to test for specificity of this CLCC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))
- Autre désignation
- CLCC1 (CLCC1 Produits)
- Synonymes
- anticorps CLCC1, anticorps clcc1, anticorps MCLC, anticorps Mclc, anticorps chloride channel CLIC like 1, anticorps Chloride channel CLIC-like protein 1, anticorps chloride channel CLIC-like 1, anticorps chloride channel CLIC-like 1 S homeolog, anticorps CLCC1, anticorps clcc1, anticorps Clcc1, anticorps clcc1.S
- Sujet
- CLCC1 seems to act as a chloride ion channel.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2
-