CLCC1 anticorps (N-Term)

N° du produit ABIN630362

Détail du produit anti-CLCC1 anticorps

Antigène: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLCC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CLCC1 antibody was raised against the N terminal of CLCC1

Purification: Purified

Immunogène: CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLCC1 Blocking Peptide, catalog no. 33R-6106, is also available for use as a blocking control in assays to test for specificity of this CLCC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLCC1

Antigène: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Autre désignation: CLCC1 (CLCC1 Produits)

Synonymes: anticorps CLCC1, anticorps clcc1, anticorps MCLC, anticorps Mclc, anticorps chloride channel CLIC like 1, anticorps Chloride channel CLIC-like protein 1, anticorps chloride channel CLIC-like 1, anticorps chloride channel CLIC-like 1 S homeolog, anticorps CLCC1, anticorps clcc1, anticorps Clcc1, anticorps clcc1.S

Sujet: CLCC1 seems to act as a chloride ion channel.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2