SLC35F2 anticorps (N-Term)

N° du produit ABIN630368

Détail du produit anti-SLC35F2 anticorps

Antigène: SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35F2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SLC35 F2 antibody was raised against the N terminal of SLC35 2

Purification: Purified

Immunogène: SLC35 F2 antibody was raised using the N terminal of SLC35 2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35F2 Blocking Peptide, catalog no. 33R-5885, is also available for use as a blocking control in assays to test for specificity of this SLC35F2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35F2

Antigène: SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))

Autre désignation: SLC35F2 (SLC35F2 Produits)

Synonymes: anticorps HSNOV1, anticorps 1500009K05Rik, anticorps AU019213, anticorps solute carrier family 35 member F2, anticorps solute carrier family 35, member F2, anticorps SLC35F2, anticorps Slc35f2

Sujet: SLC35F2 is a putative solute transporter.

Poids moléculaire: 41 kDa (MW of target protein)