SLC35F5 anticorps (C-Term)

N° du produit ABIN630371

Détail du produit anti-SLC35F5 anticorps

Antigène: SLC35F5 (Solute Carrier Family 35, Member F5 (SLC35F5))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35F5 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 F5 antibody was raised against the C terminal of SLC35 5

Purification: Purified

Immunogène: SLC35 F5 antibody was raised using the C terminal of SLC35 5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35F5 Blocking Peptide, catalog no. 33R-9476, is also available for use as a blocking control in assays to test for specificity of this SLC35F5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35F5

Antigène: SLC35F5 (Solute Carrier Family 35, Member F5 (SLC35F5))

Autre désignation: SLC35F5 (SLC35F5 Produits)

Synonymes: anticorps 1300003P13Rik, anticorps AI646727, anticorps solute carrier family 35 member F5, anticorps solute carrier family 35, member F5, anticorps SLC35F5, anticorps Slc35f5

Sujet: SLC35F5 is a putative solute transporter.

Poids moléculaire: 59 kDa (MW of target protein)