SLC6A18 anticorps (Middle Region)
-
- Antigène Voir toutes SLC6A18 Anticorps
- SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC6A18 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SLC6 A18 antibody was raised against the middle region of SLC6 18
- Purification
- Purified
- Immunogène
- SLC6 A18 antibody was raised using the middle region of SLC6 18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
- Top Product
- Discover our top product SLC6A18 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC6A18 Blocking Peptide, catalog no. 33R-6097, is also available for use as a blocking control in assays to test for specificity of this SLC6A18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))
- Autre désignation
- SLC6A18 (SLC6A18 Produits)
- Sujet
- The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions.
- Poids moléculaire
- 69 kDa (MW of target protein)
-