SLC19A1 anticorps
-
- Antigène Voir toutes SLC19A1 Anticorps
- SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC19A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
- Top Product
- Discover our top product SLC19A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC19A1 Blocking Peptide, catalog no. 33R-6599, is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))
- Autre désignation
- SLC19A1 (SLC19A1 Produits)
- Synonymes
- anticorps A1, anticorps MHCBFB, anticorps PO-GA, anticorps RECC1, anticorps RFC, anticorps RFC140, anticorps CHMD, anticorps FOLT, anticorps IFC1, anticorps REFC, anticorps RFC1, anticorps LOC100226745, anticorps AI323572, anticorps RFC-1, anticorps MTX1, anticorps XRFC, anticorps chmd, anticorps folt, anticorps ifc1, anticorps refc, anticorps rfc1, anticorps slc19a1, anticorps replication factor C subunit 1, anticorps solute carrier family 19 member 1, anticorps folate transporter 1, anticorps solute carrier family 19 (folate transporter), member 1, anticorps solute carrier family 19 (folate transporter), member 1 L homeolog, anticorps RFC1, anticorps SLC19A1, anticorps LOC100226745, anticorps Slc19a1, anticorps slc19a1.L
- Sujet
- Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-