ARMCX6 anticorps (N-Term)

N° du produit ABIN630378

Détail du produit anti-ARMCX6 anticorps

Antigène: ARMCX6 (Armadillo Repeat Containing, X-Linked 6 (ARMCX6))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARMCX6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ARMCX6 antibody was raised against the N terminal of ARMCX6

Purification: Purified

Immunogène: ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARMCX6 Blocking Peptide, catalog no. 33R-9198, is also available for use as a blocking control in assays to test for specificity of this ARMCX6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARMCX6

Antigène: ARMCX6 (Armadillo Repeat Containing, X-Linked 6 (ARMCX6))

Autre désignation: ARMCX6 (ARMCX6 Produits)

Synonymes: anticorps AW060994, anticorps ARMCX6, anticorps MGC139912, anticorps armadillo repeat containing, X-linked 6, anticorps protein ARMCX6, anticorps ARMCX6, anticorps Armcx6, anticorps LOC100060676

Sujet: The function of ARMC protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 33 kDa (MW of target protein)