RCE1/FACE2 anticorps

N° du produit ABIN630380

Détail du produit anti-RCE1/FACE2 anticorps

Antigène: RCE1/FACE2 (RCE1) (CAAX Prenyl Protease 2 (RCE1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RCE1/FACE2 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogène: RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RCE1 Blocking Peptide, catalog no. 33R-9934, is also available for use as a blocking control in assays to test for specificity of this RCE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RCE1/FACE2

Antigène: RCE1/FACE2 (RCE1) (CAAX Prenyl Protease 2 (RCE1))

Autre désignation: RCE1 (RCE1 Produits)

Synonymes: anticorps ARABIDOPSIS THALIANA FARNESYLATED PROTEIN-CONVERTING ENZYME 2, anticorps ARABIDOPSIS THALIANA FARNESYLATED PROTEIN-CONVERTING ENZYME-2, anticorps ATFACE-2, anticorps ATFACE2, anticorps ATRCE1, anticorps RAS-CONVERTING ENZYME 1, anticorps RCE1, anticorps farnesylated protein-converting enzyme 2, anticorps D19Ertd283e, anticorps D19Ertd98e, anticorps FACE2, anticorps RCE1A, anticorps RCE1B, anticorps FACE-2, anticorps Ras converting CAAX endopeptidase 1 S homeolog, anticorps Ras converting CAAX endopeptidase 1, anticorps farnesylated protein-converting enzyme 2, anticorps rce1.S, anticorps RCE1, anticorps FACE2, anticorps Rce1

Sujet: RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.

Poids moléculaire: 36 kDa (MW of target protein)