CRELD1 anticorps (C-Term)

N° du produit ABIN630381

Détail du produit anti-CRELD1 anticorps

Antigène: CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRELD1 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: CRELD1 antibody was raised against the C terminal of CRELD1

Purification: Purified

Immunogène: CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRELD1 Blocking Peptide, catalog no. 33R-9056, is also available for use as a blocking control in assays to test for specificity of this CRELD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRELD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRELD1

Antigène: CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))

Autre désignation: CRELD1 (CRELD1 Produits)

Synonymes: anticorps AVSD2, anticorps CIRRIN, anticorps AI843811, anticorps cysteine rich with EGF like domains 1, anticorps cysteine-rich with EGF-like domains 1, anticorps CRELD1, anticorps Creld1

Sujet: Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Poids moléculaire: 45 kDa (MW of target protein)