WSCD2 anticorps (C-Term)

N° du produit ABIN630386

Détail du produit anti-WSCD2 anticorps

Antigène: WSCD2 (WSC Domain Containing 2 (WSCD2))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WSCD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: WSCD2 antibody was raised against the C terminal of WSCD2

Purification: Purified

Immunogène: WSCD2 antibody was raised using the C terminal of WSCD2 corresponding to a region with amino acids GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WSCD2 Blocking Peptide, catalog no. 33R-3446, is also available for use as a blocking control in assays to test for specificity of this WSCD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WSCD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WSCD2

Antigène: WSCD2 (WSC Domain Containing 2 (WSCD2))

Autre désignation: WSCD2 (WSCD2 Produits)

Synonymes: anticorps si:ch211-240b21.1, anticorps 4933413A10Rik, anticorps C530024P05Rik, anticorps Gm450, anticorps WSC domain containing 2, anticorps WSC domain-containing protein 2, anticorps WSCD2, anticorps MGYG_08833, anticorps MGYG_08830, anticorps wscd2, anticorps Wscd2

Sujet: The WSCD2 protein possesses acetylglucosaminyltransferase activity.

Poids moléculaire: 64 kDa (MW of target protein)