TMEM126B anticorps (Middle Region)

N° du produit ABIN630389

Détail du produit anti-TMEM126B anticorps

Antigène: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM126B est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM126 B antibody was raised against the middle region of TMEM126

Purification: Purified

Immunogène: TMEM126 B antibody was raised using the middle region of TMEM126 corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM126B Blocking Peptide, catalog no. 33R-9538, is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM126B

Antigène: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Autre désignation: TMEM126B (TMEM126B Produits)

Synonymes: anticorps 1110001A23Rik, anticorps RGD1308371, anticorps transmembrane protein 126B, anticorps TMEM126B, anticorps Tmem126b

Sujet: The function of TMEM126B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 23 kDa (MW of target protein)