SLC13A3 anticorps

N° du produit ABIN630395

Détail du produit anti-SLC13A3 anticorps

Antigène: SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC13A3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC13A3 Blocking Peptide, catalog no. 33R-3423, is also available for use as a blocking control in assays to test for specificity of this SLC13A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC13A3

Antigène: SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))

Autre désignation: SLC13A3 (SLC13A3 Produits)

Synonymes: anticorps MGC108337, anticorps SLC13A3, anticorps zgc:77173, anticorps nadc3, anticorps sdct2, anticorps NADC3, anticorps SDCT2, anticorps NaDC-3, anticorps NaDC3, anticorps Nadc3, anticorps solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, anticorps solute carrier family 13 member 3, anticorps solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 L homeolog, anticorps slc13a3, anticorps SLC13A3, anticorps slc13a3.L, anticorps Slc13a3

Sujet: Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport