MOSPD3 anticorps (C-Term)

N° du produit ABIN630396

Détail du produit anti-MOSPD3 anticorps

Antigène: MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MOSPD3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: MOSPD3 antibody was raised against the C terminal of MOSPD3

Purification: Purified

Immunogène: MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MOSPD3 Blocking Peptide, catalog no. 33R-2967, is also available for use as a blocking control in assays to test for specificity of this MOSPD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOSPD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MOSPD3

Antigène: MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))

Autre désignation: MOSPD3 (MOSPD3 Produits)

Synonymes: anticorps CDS3, anticorps NET30, anticorps 1190005J19Rik, anticorps 5133401H10Rik, anticorps Gtig2, anticorps R124, anticorps cds3, anticorps MGC89012, anticorps MOSPD3, anticorps motile sperm domain containing 3, anticorps motile sperm domain containing 3 L homeolog, anticorps MOSPD3, anticorps Mospd3, anticorps mospd3, anticorps mospd3.L

Sujet: MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality.

Poids moléculaire: 24 kDa (MW of target protein)