FAM55D anticorps (C-Term)

N° du produit ABIN630400

Détail du produit anti-FAM55D anticorps

Antigène: FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))

Épitope: C-Term

Reactivité: Humain, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM55D est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: FAM55 D antibody was raised against the C terminal of FAM55

Purification: Purified

Immunogène: FAM55 D antibody was raised using the C terminal of FAM55 corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM55D Blocking Peptide, catalog no. 33R-9404, is also available for use as a blocking control in assays to test for specificity of this FAM55D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM55D

Antigène: FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))

Autre désignation: FAM55D (FAM55D Produits)

Synonymes: anticorps Fam55d, anticorps Nxpe4, anticorps C11orf33, anticorps FAM55D, anticorps C130036J11, anticorps D930028F11Rik, anticorps neurexophilin and PC-esterase domain family member 4, anticorps neurexophilin and PC-esterase domain family, member 4, anticorps Nxpe4, anticorps NXPE4

Sujet: The function of FAM55 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 60 kDa (MW of target protein)