UBE2D2 anticorps

N° du produit ABIN630401

Détail du produit anti-UBE2D2 anticorps

Antigène: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2D2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2D2 Blocking Peptide, catalog no. 33R-8733, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2D2

Antigène: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Autre désignation: UBE2D2 (UBE2D2 Produits)

Synonymes: anticorps E2(17)KB2, anticorps PUBC1, anticorps UBC4, anticorps UBC4/5, anticorps UBCH5B, anticorps 1500034D03Rik, anticorps Ubc2e, anticorps Ube2d2, anticorps ubc4, anticorps ube2d2, anticorps zgc:55886, anticorps E217kB, anticorps ubiquitin conjugating enzyme E2 D2, anticorps ubiquitin-conjugating enzyme E2D 2A, anticorps ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), anticorps ubiquitin-conjugating enzyme E2D 2, anticorps ubiquitin conjugating enzyme E2 D3, anticorps UBE2D2, anticorps Ube2d2a, anticorps ube2d2, anticorps Ube2d2, anticorps UBE2D3

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades