FAR1 anticorps (N-Term)

N° du produit ABIN630402

Détail du produit anti-FAR1 anticorps

Antigène: FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MLSTD2 antibody was raised against the N terminal Of Mlstd2

Purification: Purified

Immunogène: MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLSTD2 Blocking Peptide, catalog no. 33R-5390, is also available for use as a blocking control in assays to test for specificity of this MLSTD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAR1

Antigène: FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))

Autre désignation: MLSTD2 (FAR1 Produits)

Synonymes: anticorps MLSTD2, anticorps SDR10E1, anticorps 2600011M19Rik, anticorps 2900034E22Rik, anticorps 3732409C05Rik, anticorps AI850429, anticorps Mlstd2, anticorps mlstd2, anticorps MQJ16.4, anticorps MQJ16_4, anticorps fatty acid reductase 1, anticorps fatty acyl-CoA reductase 1, anticorps fatty acyl CoA reductase 1, anticorps fatty acyl-CoA reductase 1 L homeolog, anticorps fatty acid reductase 1, anticorps FAR1, anticorps Far1, anticorps far1.L

Sujet: MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.

Poids moléculaire: 59 kDa (MW of target protein)