ST3GAL3 anticorps (C-Term)
-
- Antigène Voir toutes ST3GAL3 Anticorps
- ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ST3GAL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ST3 GAL3 antibody was raised against the C terminal of ST3 AL3
- Purification
- Purified
- Immunogène
- ST3 GAL3 antibody was raised using the C terminal of ST3 AL3 corresponding to a region with amino acids GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD
- Top Product
- Discover our top product ST3GAL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ST3GAL3 Blocking Peptide, catalog no. 33R-3259, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))
- Autre désignation
- ST3GAL3 (ST3GAL3 Produits)
- Synonymes
- anticorps siat6, anticorps st3Gal-III, anticorps st3galii, anticorps st3galiii, anticorps st3n, anticorps SIAT6, anticorps EIEE15, anticorps MRT12, anticorps ST3GALII, anticorps ST3GalIII, anticorps ST3N, anticorps ST3GAL-III, anticorps Siat3, anticorps Siat6, anticorps ST3GALIII, anticorps st3gal3, anticorps zgc:63978, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 3 S homeolog, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 3, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 3a, anticorps st3gal3.S, anticorps ST3GAL3, anticorps St3gal3, anticorps st3gal3a
- Sujet
- ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-