CDH22 anticorps (N-Term)

N° du produit ABIN630407

Détail du produit anti-CDH22 anticorps

Antigène: CDH22 (Cadherin-Like 22 (CDH22))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDH22 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDH22 antibody was raised against the N terminal of CDH22

Purification: Purified

Immunogène: CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH22 Blocking Peptide, catalog no. 33R-5040, is also available for use as a blocking control in assays to test for specificity of this CDH22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDH22

Antigène: CDH22 (Cadherin-Like 22 (CDH22))

Autre désignation: CDH22 (CDH22 Produits)

Synonymes: anticorps C20orf25, anticorps dJ998H6.1, anticorps cadherin 22, anticorps Cdh22, anticorps CDH22

Sujet: CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins.

Poids moléculaire: 73 kDa (MW of target protein)