GPR161 anticorps (N-Term)
-
- Antigène Voir toutes GPR161 Anticorps
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPR161 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- GPR161 antibody was raised against the N terminal of GPR161
- Purification
- Purified
- Immunogène
- GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV
- Top Product
- Discover our top product GPR161 Anticorps primaire
-
anti-G Protein-Coupled Receptor 161 (GPR161) (Cytoplasmic Domain) antibody
GPR161 Reactivité: Humain, Singe, Hamster IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (Middle Region) antibodyGPR161 Reactivité: Humain, Souris, Rat, Cobaye, Boeuf (Vache), Chien, Cheval, Lapin WB Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (AA 1-28) antibodyGPR161 Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) antibodyGPR161 Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (AA 362-460) antibodyGPR161 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 1B2 unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (C-Term) antibodyGPR161 Reactivité: Humain, Boeuf (Vache), Chien, Cheval, Lapin, Porc, Singe IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (C-Term) antibodyGPR161 Reactivité: Humain, Souris, Cobaye, Boeuf (Vache), Chien, Cheval, Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (N-Term) antibodyGPR161 Reactivité: Humain, Souris, Cobaye, Porc, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (AA 201-250) antibodyGPR161 Reactivité: Humain, Souris, Boeuf (Vache), Porc, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (C-Term) antibodyGPR161 Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPR161 Blocking Peptide, catalog no. 33R-6464, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
- Autre désignation
- GPR161 (GPR161 Produits)
- Synonymes
- anticorps RE2, anticorps Gm208, anticorps Gm208Gpr, anticorps vl, anticorps RGD1563245, anticorps si:bz20i5.4, anticorps si:rp71-20i5.4, anticorps G protein-coupled receptor 161, anticorps GPR161, anticorps Gpr161, anticorps gpr161
- Sujet
- GPR161 is orphan receptor.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-
