SLC35B1 anticorps (C-Term)

N° du produit ABIN630422

Détail du produit anti-SLC35B1 anticorps

Antigène: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 B1 antibody was raised against the C terminal of SLC35 1

Purification: Purified

Immunogène: SLC35 B1 antibody was raised using the C terminal of SLC35 1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35B1 Blocking Peptide, catalog no. 33R-1334, is also available for use as a blocking control in assays to test for specificity of this SLC35B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35B1

Antigène: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Autre désignation: SLC35B1 (SLC35B1 Produits)

Synonymes: anticorps UGTREL1, anticorps Ugalt2, anticorps UGTrel1, anticorps ERNST, anticorps UGALT2, anticorps ernst1, anticorps ERNST1, anticorps wu:fj99g11, anticorps zgc:92284, anticorps solute carrier family 35 member B1, anticorps solute carrier family 35, member B1, anticorps solute carrier family 35 member B1 L homeolog, anticorps SLC35B1, anticorps Slc35b1, anticorps slc35b1, anticorps slc35b1.L

Sujet: SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

Poids moléculaire: 35 kDa (MW of target protein)