SDF4 anticorps (C-Term)

N° du produit ABIN630423

Détail du produit anti-SDF4 anticorps

Antigène: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDF4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SDF4 antibody was raised against the C terminal of SDF4

Purification: Purified

Immunogène: SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDF4 Blocking Peptide, catalog no. 33R-4609, is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDF4

Antigène: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Autre désignation: SDF4 (SDF4 Produits)

Synonymes: anticorps Cab45, anticorps SDF-4, anticorps MGC107861, anticorps wu:fb66d06, anticorps wu:fd46e11, anticorps zgc:56577, anticorps zgc:76916, anticorps CAB45, anticorps stromal cell derived factor 4, anticorps stromal cell derived factor 4 L homeolog, anticorps SDF4, anticorps sdf4, anticorps sdf4.L, anticorps Sdf4

Sujet: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Poids moléculaire: 39 kDa (MW of target protein)