ADAM30 anticorps (N-Term)

N° du produit ABIN630427

Détail du produit anti-ADAM30 anticorps

Antigène: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM30 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADAM30 antibody was raised against the N terminal of ADAM30

Purification: Purified

Immunogène: ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM30 Blocking Peptide, catalog no. 33R-8040, is also available for use as a blocking control in assays to test for specificity of this ADAM30 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM30

Antigène: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Autre désignation: ADAM30 (ADAM30 Produits)

Synonymes: anticorps svph4, anticorps 4933424D07Rik, anticorps ADAM metallopeptidase domain 30, anticorps a disintegrin and metallopeptidase domain 30, anticorps ADAM30, anticorps Adam30

Sujet: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.

Poids moléculaire: 66 kDa (MW of target protein)