MGAT2 anticorps

N° du produit ABIN630430

Détail du produit anti-MGAT2 anticorps

Antigène: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MGAT2 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogène: MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGAT2 Blocking Peptide, catalog no. 33R-7174, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MGAT2

Antigène: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Autre désignation: MGAT2 (MGAT2 Produits)

Synonymes: anticorps CDG2A, anticorps CDGS2, anticorps GLCNACTII, anticorps GNT-II, anticorps GNT2, anticorps CG7921, anticorps Dmel\\CG7921, anticorps GlcNAc-TII, anticorps GlcNAcT2, anticorps dMGAT2, anticorps MGC89475, anticorps Gnt2, anticorps AA407964, anticorps CH73-301C19.1, anticorps zgc:162268, anticorps mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, anticorps CG7921 gene product from transcript CG7921-RB, anticorps mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase L homeolog, anticorps mannoside acetylglucosaminyltransferase 2, anticorps MGAT2, anticorps Mgat2, anticorps mgat2.L, anticorps mgat2

Sujet: MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.

Poids moléculaire: 51 kDa (MW of target protein)