LRPAP1 anticorps (C-Term)

N° du produit ABIN630434

Détail du produit anti-LRPAP1 anticorps

Antigène: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRPAP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: LRPAP1 antibody was raised against the C terminal of LRPAP1

Purification: Purified

Immunogène: LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRPAP1 Blocking Peptide, catalog no. 33R-3922, is also available for use as a blocking control in assays to test for specificity of this LRPAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRPAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRPAP1

Antigène: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Autre désignation: LRPAP1 (LRPAP1 Produits)

Synonymes: anticorps wu:fi20f07, anticorps wu:fi22c06, anticorps LRPAP1, anticorps DKFZp459I2430, anticorps A2MRAP, anticorps A2RAP, anticorps HBP44, anticorps MRAP, anticorps RAP, anticorps AA617339, anticorps AI790446, anticorps AU042172, anticorps C77774, anticorps alpha-2-macroglobulin receptor-associated protein-like, anticorps low density lipoprotein receptor-related protein associated protein 1, anticorps LDL receptor related protein associated protein 1, anticorps LDL receptor related protein associated protein 1 L homeolog, anticorps LOC100231803, anticorps lrpap1, anticorps LRPAP1, anticorps Lrpap1, anticorps lrpap1.L

Sujet: LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.

Poids moléculaire: 39 kDa (MW of target protein)