CA4 anticorps (Middle Region)
-
- Antigène Voir toutes CA4 Anticorps
- CA4 (Carbonic Anhydrase IV (CA4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carbonic Anhydrase IV antibody was raised against the middle region of CA4
- Purification
- Purified
- Immunogène
- Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
- Top Product
- Discover our top product CA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1946, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CA4 (Carbonic Anhydrase IV (CA4))
- Autre désignation
- Carbonic Anhydrase IV (CA4 Produits)
- Synonymes
- anticorps CAIV, anticorps Car4, anticorps RP17, anticorps AW456718, anticorps Ca4, anticorps ca4, anticorps caiv, anticorps car4, anticorps rp17, anticorps CA4, anticorps zgc:171842, anticorps carbonic anhydrase 4, anticorps carbonic anhydrase 4 S homeolog, anticorps carbonic anhydrase IV a, anticorps CA4, anticorps Car4, anticorps ca4, anticorps ca4.S, anticorps Ca4, anticorps ca4a
- Sujet
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
- Poids moléculaire
- 34 kDa (MW of target protein)
-