IL-10RA anticorps (N-Term)
-
- Antigène Voir toutes IL-10RA (IL10RA) Anticorps
- IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-10RA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IL10 R Alpha antibody was raised against the N terminal of IL10 A
- Purification
- Purified
- Immunogène
- IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
- Top Product
- Discover our top product IL10RA Anticorps primaire
-
anti-Interleukin 10 Receptor, alpha (IL10RA) (AA 132-235) antibody
IL10RA Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (AA 22-230) antibodyIL10RA Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) antibodyIL10RA Reactivité: Humain, Souris, Rat IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (AA 147-175) antibodyIL10RA Reactivité: Humain WB, FACS, IF Hôte: Lapin Polyclonal RB23343 unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (Ser560) antibodyIL10RA Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) antibodyIL10RA Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (pTyr496) antibodyIL10RA Reactivité: Humain WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (C-Term) antibodyIL10RA Reactivité: Humain WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (AA 128-177) antibodyIL10RA Reactivité: Humain, Boeuf (Vache), Porc, Cheval, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Interleukin 10 Receptor, alpha (IL10RA) (AA 132-235) antibodyIL10RA Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal C9 unconjugated
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))
- Autre désignation
- IL10R alpha (IL10RA Produits)
- Sujet
- IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Growth Factor Binding
-
