NEU1 anticorps

N° du produit ABIN630439

Détail du produit anti-NEU1 anticorps

Antigène: NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEU1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEU1 Blocking Peptide, catalog no. 33R-9913, is also available for use as a blocking control in assays to test for specificity of this NEU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEU1

Antigène: NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))

Autre désignation: NEU1 (NEU1 Produits)

Sujet: NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome