NEU1 anticorps
-
- Antigène Voir toutes NEU1 Anticorps
- NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NEU1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
- Top Product
- Discover our top product NEU1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NEU1 Blocking Peptide, catalog no. 33R-9913, is also available for use as a blocking control in assays to test for specificity of this NEU1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NEU1 (Sialidase 1 (Lysosomal Sialidase) (NEU1))
- Autre désignation
- NEU1 (NEU1 Produits)
- Synonymes
- anticorps NANH, anticorps NEU, anticorps SIAL1, anticorps MGC81958, anticorps AA407268, anticorps AA407316, anticorps Aglp, anticorps Apl, anticorps Bat-7, anticorps Bat7, anticorps G9, anticorps Map-2, anticorps Neu, anticorps Neu-1, anticorps neuraminidase 1, anticorps neuraminidase 1 (lysosomal sialidase) L homeolog, anticorps NEU1, anticorps neu1.L, anticorps neu1, anticorps Neu1
- Sujet
- NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-