CYP3A7 anticorps (Middle Region)
-
- Antigène Voir toutes CYP3A7 Anticorps
- CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP3A7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP3 A7 antibody was raised against the middle region of CYP3 7
- Purification
- Purified
- Immunogène
- CYP3 A7 antibody was raised using the middle region of CYP3 7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
- Top Product
- Discover our top product CYP3A7 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP3A7 Blocking Peptide, catalog no. 33R-4668, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))
- Autre désignation
- CYP3A7 (CYP3A7 Produits)
- Synonymes
- anticorps CP37, anticorps CYPIIIA7, anticorps P450-HFLA, anticorps cytochrome P450, family 3, subfamily A, polypeptide 7, anticorps cytochrome P450 family 3 subfamily A member 7, anticorps CYP3A7
- Sujet
- CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-