CYP2A13 anticorps (C-Term)
-
- Antigène Voir toutes CYP2A13 Anticorps
- CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP2A13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP2 A13 antibody was raised against the C terminal of CYP2 13
- Purification
- Purified
- Immunogène
- CYP2 A13 antibody was raised using the C terminal of CYP2 13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
- Top Product
- Discover our top product CYP2A13 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP2A13 Blocking Peptide, catalog no. 33R-2112, is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))
- Autre désignation
- CYP2A13 (CYP2A13 Produits)
- Synonymes
- anticorps CPAD, anticorps CYP2A, anticorps CYPIIA13, anticorps MGC86391, anticorps MGC88881, anticorps CYP2A13, anticorps CYP2A6, anticorps cytochrome P450 family 2 subfamily A member 13, anticorps cytochrome P450, family 2, subfamily A, polypeptide 13, anticorps cytochrome P450 family 2 subfamily A member 13 L homeolog, anticorps cytochrome P450 family 2 subfamily A polypeptide 13, anticorps cytochrome P450 2A13, anticorps CYP2A13, anticorps cyp2a13.L, anticorps cyp2a13, anticorps LOC540707
- Sujet
- CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.
- Poids moléculaire
- 54 kDa (MW of target protein)
-