UGT3A2 anticorps (N-Term)

N° du produit ABIN630444

Détail du produit anti-UGT3A2 anticorps

Antigène: UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT3A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT3 A2 antibody was raised against the N terminal of µgT3 2

Purification: Purified

Immunogène: UGT3 A2 antibody was raised using the N terminal of µgT3 2 corresponding to a region with amino acids HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT3A2 Blocking Peptide, catalog no. 33R-3804, is also available for use as a blocking control in assays to test for specificity of this µgT3A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT3A2

Antigène: UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))

Autre désignation: UGT3A2 (UGT3A2 Produits)

Synonymes: anticorps AI313915, anticorps UDPGT 3A1, anticorps ugt3a1, anticorps ugt3a2, anticorps UDP glycosyltransferase family 3 member A2, anticorps UDP glycosyltransferases 3 family, polypeptide A2, anticorps UDP glycosyltransferase 3 family, polypeptide A2 L homeolog, anticorps UGT3A2, anticorps Ugt3a2, anticorps ugt3a2.L

Sujet: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Poids moléculaire: 59 kDa (MW of target protein)